SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006736 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006736
Domain Number 1 Region: 1012-1348
Classification Level Classification E-value
Superfamily NHL repeat 6.02e-26
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1246-1491
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000101
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.015
Further Details:      
 
Domain Number 3 Region: 707-782
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000216
Family Pre-dockerin domain 0.073
Further Details:      
 
Domain Number 4 Region: 448-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000605
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006736   Gene: ENSMGAG00000006585   Transcript: ENSMGAT00000007492
Sequence length 1801
Comment pep:novel chromosome:UMD2:4:20962077:21091469:-1 gene:ENSMGAG00000006585 transcript:ENSMGAT00000007492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQPPNNQGQSTLQPLPPSHKQHSAQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTTP
ESVQLQDSWVLGSNAPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNT
LSRSAFKFKKSSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFEN
GKVNSDTVPTHPVTVPAGENGKLGGFAQENNTIDSGELDIGRRAIQEVPPGIFWRSQLFI
DQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRTLLEAERAGR
QTRSVSLHEAGFIQYLDSGIWHLAFYNDGKNAEQVSFNTIIIESVVECPRNCHGNGECVS
GSCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCYSGWKGTECDVPATQCIDPQCGGR
GICIMGSCACNSGYKGENCEEADCLDPACSSHGVCIHGECHCNPGWGGSNCEILKTLCPD
QCSGHGTYLQESGTCTCDPNWTGPDCSNEICSVDCGTHGVCMGGTCRCEDGWTGTACNQR
ACHPRCAEHGTCKDGKCECSQGWNGEHCTIAHYLDKIVKEGCPGLCNSNGRCTLDQNGWH
CVCQPGWRGAGCDVAMETLCTDSKDNEGADGLVDCMDPDCCLQSSCQNQPYCRGLPDPQD
IISQSQQSPSQQAAKAFYDRISFLIGADSTHVIPGESPFNKSLASVIRGQVLTADGTPLI
GVNVSFLHYPDYGYTITRQDGMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMD
TLVMKKEENDIPSCDLSGFVRPNPIIVSSPLSTLFRISPEDSPIIPETQVLHEETTIPGT
DLKLSYLSSRAAGYKSVLKITMTQSVIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFI
WDKTDAYNQRVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHH
VLDVQNGILYKGNGENQFISQQPPIVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALAC
GIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRHSNNPAHRYYLATDPVTGDLYVSDT
NTRRIYRPRSLAGAKDLTKNAEVVGGTGEQCLPFDEARCGDGGKAVEATLMSPKGIAIDK
NGLIYFVDGTMIRKVDQNGIISTLLGSNDLTSARPLTCDTSMHISQVRLEWPTDLAINPM
DNSIYVLDNNVVLQITENRQVRIAAGRPMHCQVPGVEYTVGKHAVQTTLESATAIAVSYS
GVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDVNCDCYQSGDGYAKDAKLNA
PSSLAVSPDGTLYIADLGNIRIRAVSKNRPLLNSMNFYEVASPTDQELYIFDVNGTHQYT
VSLVTGDYLYNFSYSNDNDITSVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNG
CLKSMTAQGQELVLFTYHGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHG
EMERAITVDIESSSREEDVSITSNLSSIDSFYTMVQDQLRNSYQIGYDGSLRILYASGLD
SHYQTEPHVLAGTANPTVAKRNMTLPGENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRN
LLSVDFDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMAVNVTYSSTGQIGSIQ
RGTTSEKIEYDGQGRIVSRVFADGKTWSYTYLEKSMVLLLHSQRQYIFEYDLLDRLSAVT
MPSVARHTMQTIRSIGYYRNIYNPPESNASVIMDYNEEGQLLQTAFLGTSRRVLFKYRRQ
T
Download sequence
Identical sequences G1N4G9
ENSMGAP00000006736 ENSMGAP00000006736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]