SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006759 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006759
Domain Number 1 Region: 26-214
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.12e-72
Family Papain-like 0.000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006759   Gene: ENSMGAG00000006705   Transcript: ENSMGAT00000007516
Sequence length 215
Comment pep:known chromosome:UMD2:Z:43965587:43966997:-1 gene:ENSMGAG00000006705 transcript:ENSMGAT00000007516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRFVNMDVCLTILSLCLGLVFAAPRLDPDLDSHWQLWKSWHSKDYHEREESWRRVVWEKN
LKMIELHNLDHSLGKHSYKLGMNQFGDMTTEEFRQLMNGYIHKKSERKYRGSQFLEPSFL
EAPRSVDWREKGYVTPVKDQGQCGSCWAFSTTGALEGQHFRKTGKLVSLSEQNLVDCSRP
EGNQGCNGGLMDQAFQYVQDNGGIDSEESYPYTAK
Download sequence
Identical sequences G1N4I7
ENSMGAP00000006759 ENSMGAP00000006759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]