SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006788 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006788
Domain Number 1 Region: 50-521
Classification Level Classification E-value
Superfamily Sema domain 1.7e-152
Family Sema domain 0.0000000628
Further Details:      
 
Domain Number 2 Region: 517-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000349
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006788   Gene: ENSMGAG00000006680   Transcript: ENSMGAT00000007545
Sequence length 1081
Comment pep:novel chromosome:UMD2:12:9753690:9766084:1 gene:ENSMGAG00000006680 transcript:ENSMGAT00000007545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLCASVMLMSLSQCRAVSFPEDEDPINIVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEVPKSEVTPSRKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLDYDGEEISGLARCPFDARQTNVALFAD
GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
AVEHNNIGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSI
TDIIEINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPED
KVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPSIIEEPWFTKTRVSLD
RYRLTAIAVDHAAGPHQNYTVIFVGSEAGVVLKILAKTRPFSLNDSVLLEEIEAYNHAKC
NAENEDDRRVISLQLDRDHHALFVAFSSCVIRIPLSRCERHGSCKKACIASRDPYCGWLD
HEVCGRVTPGMPTGGYVQDVEYGNTAQLGDCHEILPTTATPDYKIFGDPTSDMKFSSASI
TTMASIPVISPRVIGSWKPKVTGSRKFVVQDDPNTSDYSDPLSGVPKGVRWEVQSGESNQ
MVHMNVLITCVFAAFVLGAFIAGVAVYCYRDVFVRKSRKIHKDAESAQSCTDSSGSFAKL
NGLFDSPVKEYQQNIDSPKLYTNLLTSRKELPPNGDMKSMMMDHRGQPPELAALPTPEST
PVLQQKTLQAMKSQSDKAHSNLNASRKETPLKSPQFFPSSPPPHSPLSHGQIPSAIVLPN
ATHDYNTSFSNSNAHKADKKMQHIDHPLTKPSSKRDHRRSVDSRNTLNDFLKHLNETTSN
PKAIMGDIQVAHQTLMLDPMGNMSEIPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPA
VPMTSLERQRGYHKNSSQRHSISALPKNLNSPNGVLLSRQPSINRGGYVTPTAGTKMDYM
QGTPVSVHLQPSLSRQSSYTSNGTLPRTGIKRTPSLKPDVPPKPSFVPQTTSVRPLNKYS
Y
Download sequence
Identical sequences G1N4K8
ENSMGAP00000006788 ENSMGAP00000006788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]