SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006861 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006861
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-16
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 252-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000608
Family LIM domain 0.00091
Further Details:      
 
Domain Number 3 Region: 219-251
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000044
Family LIM domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006861   Gene: ENSMGAG00000006800   Transcript: ENSMGAT00000007623
Sequence length 296
Comment pep:novel chromosome:UMD2:8:19133785:19160000:1 gene:ENSMGAG00000006800 transcript:ENSMGAT00000007623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTPGSKAAIANLCIGDQIIAIDGVNTGNMTHLEAQNKIKGCADELTLTVSRTESKVWSP
LVNEEGKAHPYKMNLASQPQEIRHIGSAHNRSAVPFTAATASAPKVITAQYNSPAGLYSS
ENIQTFNNAVESKTSPGPPEPSKLLDQHSHPSGSIAIDRDSEVYKMLQENQESHEPPRQS
ASFLVLQEILESEEKGDPSKPSGFRSVKAPTTKVASSIGNAQKLPMCDKCGSGIVGVFVK
IRDKQRHPECYVCSDCGTNLKQKGHFFVEDQIYCEKHARERVVPPEGYEVVTVFPK
Download sequence
Identical sequences G1N4R5
ENSMGAP00000006861 ENSMGAP00000006861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]