SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006951 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006951
Domain Number 1 Region: 1085-1399
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.18e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000418
Further Details:      
 
Domain Number 2 Region: 869-1047
Classification Level Classification E-value
Superfamily ARM repeat 1.27e-59
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000729
Further Details:      
 
Domain Number 3 Region: 363-532
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.82e-39
Family Ras-binding domain, RBD 0.017
Further Details:      
 
Domain Number 4 Region: 687-851
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-35
Family PLC-like (P variant) 0.024
Further Details:      
 
Domain Number 5 Region: 1429-1548
Classification Level Classification E-value
Superfamily PX domain 3.4e-29
Family PX domain 0.0012
Further Details:      
 
Domain Number 6 Region: 1566-1693
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.29e-24
Family Synaptotagmin-like (S variant) 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006951   Gene: ENSMGAG00000006883   Transcript: ENSMGAT00000007715
Sequence length 1697
Comment pep:novel chromosome:UMD2:5:11574887:11612235:-1 gene:ENSMGAG00000006883 transcript:ENSMGAT00000007715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLSSSNEFKQRSSPSLATARSKDVDKEEALQMEAEALAKMQKERGIAGNKQTSRSLSS
IGQKAQTHSKQDHDLMVFPESDAKRMKDKLSTIDIEKLTHAELEKLLLDDSFESSKVPAL
PVTPILSPSLSSQFYIGPTGQTGQWTPGIPAPVTCTLPPIYPSASYIKQTGVFQNGFHPS
MSSYHSREPIYFGLPRQSQYISYPLAATTPFHPQGSLPIYPPVLTPELAKVFDKIASTSE
FLRNGKSSTDLEMTAIKSAVSSLPASEKCRDISKFDWLDLDPLSKPKSKPKVDSVETLYK
AEDHGELASGMTAEDPWDAVLLEEKLLVTCHLERKINGKSSGATVTRSQSLNMRTAQLGK
LQGQTSQKDNGTTGTLTENVLLQEIEGQNQELSAFSQAVTKLRTKFPYTNQQSNPGFVLS
PIMLQRNIAGESASIKVSIEIKGFQQPVTFTCDVSSPVELIIMQALCWVHDDLNEVDIGS
YFLKVCGQEEVLQNKHCVGSHEYIQNCRKWDTEIKLQLVTHTEICRGLARTEEDDRTPID
LTKHLYKVEKPFREPNIRSSIEELLDIYHKQTEIALKNENQHKAVDHLIKTVRKICSTLD
GVETPAITESVKKLRRAVNLPRIKDTEVSLKCGDDSSKSASGSLQPESPLKVNIDLLTRA
VEALLRLHMNSCSSSSAAVSPKDKTTKEAWTATEHLQFTIFAAHRIFPDWVSNFEKYYLI
CSLTHNGKDLFKPVQSKKAGAYKNFFYLIKWDELIIFPIQISQLPLESVLCLTLFGILNQ
SSGSSPDSNKQRKGPEMLGQVSLPLFDFRRLLSCGTKLLQLWTSLHPSHASGTASKKENM
GRIVLQVDFPSHAFDIEYKIPQAAKTTVHHSIEALEKPLRERLLAILSRDNTIGLSKEDK
EFLWERRHYCHSHTNSLPKILASAPHWDWASLPEIYSLLQQWPPLSPLAALELLDSKFAD
QEVRNTAVNWIETLSDDELTDFLPQFVQALKYETYLDSALVKFLLARALGNIRIAHYLYW
LLKDTLYDPKFGIRYEQILGAFLSVCGKGLREELEKQTRLVLLFGMVAEKVKQTSVSGRQ
TALQSGMERVQSFFLKNKCRLPLNPSLVAKELNIKACSFFSSNAVPLKIALINADPLGEE
INVMFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCLSTGKDRGMVELVPASET
LRKIQVEYGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVLGICDRH
NDNIMLRNTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLF
VDLCCQAYNLIRKHANLFLNLLSLMLSSGLPELSGVQDLKYVQDALQPQTTDAEATIFFT
RLIESSLGSVATKFNFFIHNLAQLRFSGLPSNDEPILSFSAKTYSLKQDGRIKQVSVFTY
QKRYNPDKHYIYVVRVLREGQAEPTFVFRTFDEFQELHNKLGILFPLWKLPGFPNKMVLG
RTHIKDVAAKRKVELNSYIQSLMNSSPEVAECDLVYTFFHPLLRDDKVEGIDGIARSTDA
SPSSPTSGKVGGEVKLSISYRNSTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSK
RKTKISRKTRNPTFNEMLVYSGYSVETLKQRELQLSVLSAESLRENFFLGGITLSLKDFN
LSKETVNWYRLTAVPYL
Download sequence
Identical sequences G1N4Y9
ENSMGAP00000006951 ENSMGAP00000006951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]