SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007001 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007001
Domain Number 1 Region: 90-177
Classification Level Classification E-value
Superfamily SAND domain-like 1.38e-30
Family SAND domain 0.0000112
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000007001
Domain Number - Region: 249-346
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00188
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007001   Gene: ENSMGAG00000006922   Transcript: ENSMGAT00000007766
Sequence length 530
Comment pep:novel chromosome:UMD2:22:10630583:10640774:1 gene:ENSMGAG00000006922 transcript:ENSMGAT00000007766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDVSVHMEEVVVVTTPDTAVDGSGVEEVKTVLVTTNLSQHGSDINEDTLETENAAAA
AAAAFTASTHLKEAVLEVKMAEDDDSLEAEIVYPITCGDSKANLIWRKFVCPGINVKCVQ
FDGHLISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDLGELDFYQHTKVCSNTCRSTK
IDLTGARVSLSSQTSTEYIPLTPASTDVNGSPATITIETCEDASDWTTSIGDDTFAFWRG
LRDAGLLDDVIQEFHQELLDTMRGLQQRAQDPPLQLGDAVLLNNVVQNFRMLDLVKKVLA
SHKCQMDRSREQYTRDLAALEQQCDEHRKRAKELKHKSQHLNNVLMTLTPVSVPTPLKRP
RLTRATSGPAAITSQVLSQPAQIAVTPAVPMSQLTSLPLGKVVSTLPSSVLGKTPSQPPA
ASSPASPLLGGYTVLASAGNAFPGAVEIHPDAPNVTVLSTAAATAQDSSTVVKVLSPFQL
LALPGLGAAIQNVTHVGGGGAVLSVPSEGPTAEHTAAIEVTAVADEAEQK
Download sequence
Identical sequences G1N521
ENSMGAP00000007001 ENSMGAP00000007001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]