SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007031 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007031
Domain Number 1 Region: 54-252
Classification Level Classification E-value
Superfamily E set domains 1.59e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.000002
Further Details:      
 
Domain Number 2 Region: 13-69
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000251
Family Voltage-gated potassium channels 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007031   Gene: ENSMGAG00000006961   Transcript: ENSMGAT00000007796
Sequence length 283
Comment pep:novel chromosome:UMD2:5:11683734:11685226:-1 gene:ENSMGAG00000006961 transcript:ENSMGAT00000007796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKGTAASCVTISITVTSAFLFSIEVQVTIGFGGRMVTEECPAAILVLIVQNIVGLVINAI
MLGCIFMKTSQAHRRAETLIFSKHAVIALRDGKLCFMLRVGDLRKSMIISATIRMQVVKK
TSSLEGEVVPLNQIDIQMENPVGGNSIFLVSPLIIYHVIDKNSPLYDISPTNLHHHEDLE
IIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGQYSVDYSKFGNTVKVPTP
SCTARQLEEDKSIMDTVPFSPRSTIRKRSIKLKPKFTISDEPS
Download sequence
Identical sequences G1N545
ENSMGAP00000007031 ENSMGAP00000007031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]