SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007040 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007040
Domain Number 1 Region: 42-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-48
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007040   Gene: ENSMGAG00000006965   Transcript: ENSMGAT00000007805
Sequence length 276
Comment pep:novel chromosome:UMD2:22:10686005:10690364:-1 gene:ENSMGAG00000006965 transcript:ENSMGAT00000007805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVVRFEECVLQRHGLGQRMSHGNKRSQLYLRLVETSLKGERILGYAEEPCYLWFVMEFC
EGGDLNQYVLSRRPDPATNRSFMLQLTSAIAFLHKNHIVHRDLKPDNILITEKSGTPVLK
VADFGLSKVCAGLTARGKKGGHENKNVNVNKYWLSSACGSDFYMAPEVWEGHYTAKADIF
ALGIIIWAMIERLTFIDAETKRELLGTYIKQGTEIVPVGEALLENPKMELHIPQKRRTSM
SEGIKQLLKDMLAANPQDRPDAFELETRMDQVTCAA
Download sequence
Identical sequences G1N551
ENSMGAP00000007040 ENSMGAP00000007040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]