SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007176 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007176
Domain Number 1 Region: 32-225
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.77e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000483
Further Details:      
 
Domain Number 2 Region: 221-250
Classification Level Classification E-value
Superfamily E set domains 0.00000017
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007176   Gene: ENSMGAG00000007084   Transcript: ENSMGAT00000007943
Sequence length 250
Comment pep:novel chromosome:UMD2:8:14531074:14532760:-1 gene:ENSMGAG00000007084 transcript:ENSMGAT00000007943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSQCLDGIDYDDFSFGSHMVEQKEPLMETAVGPYLVIIEQPKQRGFRFRYGCEGPSHGGL
PGASSEKGHKTYPTVKICNYEGVARIEVDLVTHSDPPRVHAHSLVGKQCNEAGNCVVIVG
PKDMTAQFSNLGVLHVTKKNMMEIMKEKLKKQKTRNTNGLLTEAELREIELEAKELKKVM
DLSIVRLRFTAYLRDSSGNFTLALQPVISDPIHDSKSPGASNLKISRMDKTAGSVRGGDE
VYLLCDKVQK
Download sequence
Identical sequences G1N5F5
ENSMGAP00000007176 ENSMGAP00000007176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]