SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007224 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007224
Domain Number 1 Region: 72-182
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-23
Family PDZ domain 0.0053
Further Details:      
 
Domain Number 2 Region: 219-290
Classification Level Classification E-value
Superfamily PDZ domain-like 8.41e-21
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 3 Region: 743-844
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-20
Family PDZ domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007224   Gene: ENSMGAG00000007082   Transcript: ENSMGAT00000007993
Sequence length 883
Comment pep:novel chromosome:UMD2:5:11772976:11821938:-1 gene:ENSMGAG00000007082 transcript:ENSMGAT00000007993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRVAREFRHKVNLLIDNEAEKDYLYDVLRMYHQSMNLPVLVGDLKLVINEPSRLPLFD
AIRPLIPLKHQVEYDQLTPKRSRKLKEVRLDRLHPEGLGISVRGGAEFSCGLFISQLVKG
GQADNVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKIVSIKVRHVGMIPVKSSADEPL
KWQYVDQFVSDSGEGKGSVAGLASSGGRDSKEKKVFISLIGTKGMGCSISSGPTQKPGIF
VSNVKPGSLSAEVGLEVGDQIVEVNGVDFSNVDHKEAVRVLKSSRTLTISVVAGAGKELF
MTEEERQREAHLRELERQELMHQKRLAVETNKIIKEQQEKERFRMEQLDLEGVAHDQLET
DDMDEVIMKQDKQFMHLHVHSSLWETAFHLILSTTVFCKLEQLFLYLFVAFGWFYRYEGK
FPTIRKKGKERKKSKSDSFCEQKKNKKEMEFEQRLAKEKEGMLEKEKQLKINRLVQEVSE
TEREDLEESEKVQHWVERLCQTRLEQISSVENESPEVLPSDEESCSDCALESRREYYGLK
LHKLKSPELPEDLYFMDPKAVFFLPVQDRIEPRIDLRPPVILEITAEEEKFKKEWEEDWG
PKEPPKPLKTVTAEVHSAPRSKHKSKFSERPWEFGRLGNPRDDWIVKVHRLNGTNAKSRN
EIFPIILLVKPKQFAPSPPTQRHPGVPIISKPVMLHPDPNLMVRPTIKSEALPQEMFKRM
VVYNSSFRSNKKQKYVEDFDPHSMFTPEQIVGKDVRLLRIRKEGSLDLAVEGGIDSPVGK
IVVSAIYEGGAADKHGGIVKGDEILAVNGKIVIDCRLAEAQATLANAWNMGGDWIDLVIA
VSPPKEYDDEIPTIPTSTVSPNTHRKVFEGSAPVYRQGYLLQL
Download sequence
Identical sequences G1N5I9
ENSMGAP00000007224 ENSMGAP00000007224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]