SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007309 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007309
Domain Number 1 Region: 364-517
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.36e-28
Family Dual specificity phosphatase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 1-159,186-277
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000161
Family Protein kinases, catalytic subunit 0.0082
Further Details:      
 
Domain Number 3 Region: 556-672
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000523
Family PLC-like (P variant) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007309   Gene: ENSMGAG00000007161   Transcript: ENSMGAT00000008081
Sequence length 982
Comment pep:novel chromosome:UMD2:Z:56296922:56337105:-1 gene:ENSMGAG00000007161 transcript:ENSMGAT00000008081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGFAFVYEAQDLGSGKDYALKRLLSNEEEKNKAIIQEVCFMVSFSGYRAEMKVLPTALSR
VDLNKTCQRTFPYFSAQCEGQAADLLSRKHSTAKLGQNLLLEITYKTAYQHLSWRKKKIK
NKKNKIKQIHISTCKTLYILKACHISLELDLEYSAEQQCLIQKISIQKNGYMIFKNLQIQ
EFLYLKTVPKGEKTNHDALGCILYLLCFRQHPFEDGAKLRIVNGKYAIPQNDTRYSVFHD
LIRSTLKVNPEERLSITELVNQLQEIAAARNVNPKSPITELLEQNGGYGNNAQPRISVTS
VSQSSKPAGQLNNIYNAGLTVAECDQTYGGFFDILRGGTERFFTNIKDTSSKVIQSVANY
AKGDLDISYITSRIAVMSFPAEGVESAIKNNIEDVRLCLDSKHPGHYAVYNLSPRTYRPS
RFHNRVSECGWPARRAPNLQNLYSICKNMHLWLKQDQKNVCIVHCLDGRAASAVVVCSFL
CFCRLFTTAEAAVYMFSMKRCPPGIWPSHKRYAKYLEKPVCYESSSSEFGETLVANGVLS
TAELNMICREAVVRIKIRVCCPKCKVFFLIKRVRSRNLVYCMLSFFKYVTLKSVIKKHLT
NCGNVRLVQSHSREILGFSFQQMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEK
YPDLFQVNLEVEVEPRDRPSCEQLPWDNMNIKGLNPKILFSTREEQQEILSKFGKPELPR
QPGSTAQYEAEASQLDLSSESAPTETESPHSSGTDANNFFHSLDWKEGKSPESGIDDNSS
KNDHVQLSDEREESDPSDEEFPTFPGEERAVTVDEGDSVTPGGEMLFEAGFEAPPALLQK
SLTEENVDLLGLNSDTSTDQKQPVSEINSSSNAALLNNLFVSGASQVSEEPTGDLLGQGA
DFFFSGQPQHPAATQKTSAATVSSADPFDPFTMSSSSENSALPGPDLFGDFLNPSTASTA
NTFPSTHSSLPPSSSSDFLNLG
Download sequence
Identical sequences G1N5Q6
ENSMGAP00000007309 ENSMGAP00000007309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]