SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007471 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007471
Domain Number 1 Region: 265-566
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-89
Family Protein kinases, catalytic subunit 0.0000000197
Further Details:      
 
Domain Number 2 Region: 99-225
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.14e-36
Family Synaptotagmin-like (S variant) 0.00000172
Further Details:      
 
Domain Number 3 Region: 41-96
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00018
Further Details:      
 
Domain Number 4 Region: 2-30
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000115
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007471   Gene: ENSMGAG00000007318   Transcript: ENSMGAT00000008246
Sequence length 616
Comment pep:novel chromosome:UMD2:20:7650184:7758680:1 gene:ENSMGAG00000007318 transcript:ENSMGAT00000008246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHC
GSLLYGLLHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTGDKLEVTVR
EAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTFRSTLNPHWNESFTFKLKPTDKDR
RLSVEVWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPDADEDGN
AELRQKFEKAKLGPAGNKVITPSEDRSSSVPSNNLDRVKLTDFNFLMVLGKGSFGKVMLA
DRKNTEELYAIKILKKDVVIQDDDVECTMVEKRVLALQDKPPFLTQLHSCFQTVDRLYFV
MEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISVGLFFLHNRGIVYRDLKLDNVMLDSEGH
IKIADFGMCKEHMLDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQP
PFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGLEGERDIREHAF
FRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGF
SYVNPQFVHPLLENVA
Download sequence
Identical sequences G1N621
ENSMGAP00000007471 ENSMGAP00000007471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]