SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007533 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007533
Domain Number 1 Region: 47-514
Classification Level Classification E-value
Superfamily Ras GEF 6.54e-121
Family Ras GEF 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007533   Gene: ENSMGAG00000007408   Transcript: ENSMGAT00000008310
Sequence length 518
Comment pep:novel chromosome:UMD2:4:26686423:26701199:1 gene:ENSMGAG00000007408 transcript:ENSMGAT00000008310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLCCFECLSCAATLPAAGMIPSFECRTPTHLLIILSSVCVSLQERMPQTPPFAAMFDSS
SYNRNLYQSKEDGCGGLYYHDNNLLSGSLEALIQHLVPSVDYYPDRTYIFTFLLSSRLFM
HPYELMAKVCHLCIEQQRLSEPGQDKNRIRKIAPKILQLLTEWTETFPYDFRDERMMRNL
KELAQRITSGDEMYRKNVQQLLQNLLRKLATVSQYEEVLAKINATSTDRLTVLKTKPQSI
QRDIITVCNDPYTLAQQLTHIELERLNYIGPEEFVQAFVQKDPLDNDKSCYGDRKKSRNL
EAYVEWFNRLSYLVATEICMPVKKKHRARVIEYFIDVARECFNIGNFNSLMAIISGMNMS
PVSRLKKTWAKVKTAKFDILEHQMDPSSNFYNYRTALRGATQRSLTAHSNREKIVIPFFS
LLIKDIYFLNEGCANRLPNGHVNFEKFWELAKQVSEFMSWKQVECPFERDRKILQYLLTV
PVFSDDALYLASYESESPENHVEKDRWKTLRSTLLGRV
Download sequence
Identical sequences G1N673
ENSMGAP00000007533 ENSMGAP00000007533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]