SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007730 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007730
Domain Number 1 Region: 4-469
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-114
Family Ras GEF 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007730   Gene: ENSMGAG00000007555   Transcript: ENSMGAT00000008511
Sequence length 474
Comment pep:novel chromosome:UMD2:15:13842962:13867581:1 gene:ENSMGAG00000007555 transcript:ENSMGAT00000008511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGMPQTLSSTSMFTPCSFSPHLHTSKEDEQGGLIFQDGNLTSASLDALIQHLIPTTDYY
PEKAYIFTFLLSSRLFIEPHELLSRVCHKCIEQQRLDDPVLDKARIRKFGPKILQLLTEW
TETFPYDFQEERMIGHLKDMIHRIAPCDEAYWKKMNQLLQTLNQKLATLSHGQEGIVKIN
AAVSDKLVAFKSKPPSIQREILSVCSDPYTLAQQLTHVELERLSHIGPEEFVQAFVHKDP
LDGTKPCFSDQKTSNLEAYVKWFNRLCYLVATEICMPAKKKQRAQVIEFFIDVARECFNI
GNFNSLMAIISGMNMSPVSRLKKTWSKVKTAKFFILEHQMDPTGNFYNYRTALRGAAHRS
LTAHSNREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAKQVGEFITWKQVE
CPFEQDANIIHYLHTAPIFTEDGLYLASYESESPENQTEKDRWKSLRSTILGKT
Download sequence
Identical sequences G1N6K7
ENSMGAP00000007730 ENSMGAP00000007730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]