SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007932 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007932
Domain Number 1 Region: 1019-1294
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.9e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000443
Further Details:      
 
Domain Number 2 Region: 177-275
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-24
Family PDZ domain 0.000052
Further Details:      
 
Domain Number 3 Region: 602-690
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-22
Family PDZ domain 0.017
Further Details:      
 
Domain Number 4 Region: 313-419
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-21
Family PDZ domain 0.023
Further Details:      
 
Domain Number 5 Region: 694-788
Classification Level Classification E-value
Superfamily PDZ domain-like 7.06e-19
Family PDZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007932   Gene: ENSMGAG00000007675   Transcript: ENSMGAT00000008720
Sequence length 1309
Comment pep:novel chromosome:UMD2:4:26922649:26945544:-1 gene:ENSMGAG00000007675 transcript:ENSMGAT00000008720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSTSHLTNGTRTYVRRPSSVQDNEAESSSEQPSRSRAHQRAVAGSVSALSGGRRDGSVS
SQDSRTESASLSQSQTASCFGRRASGRAQQDAQKYNDSQSGVLKTSEKRRSSSDSTRAKM
KRSGVVESVEYSDRGDSDMDEATYSSSQEQHVAQKAQESSSANAADKMNSKKVSAELLKP
GDIFEVELAKKDNGLGISVTVLFDKGGVNTSIKHGGIYVKAVIPKGAAEEDGKIEKGDRV
LSVNGVSLEGATHKQAVEMLRNTGQVVHLLLEKGQLSVAKAHAPVTPQCTPPNLVGLCEP
QEKPATRTTNTKDYSFVTAENTFEVKLLKNSSGLGFSFCREDNPTPEQLGSTIVRVKKLF
PGQPAAESGQIDIGDVILKVNGASLNGLSQQEVISALRGTSPEVSLLLCRPPPGILPDID
PALLTPINSPLQVFPDVNREVSGPSNEEQGDSSDENETTDLSKRRLKSPSRRDSYSDSSR
SGDEETMDSLAQSGHSWNSALCQPPDEAVTQEHSQHEAHSAQGSALRTILYSAHETPSSS
EHENSTLLLDLKSIPPCRTIPEVTTSVLINSCYAAPASELPPRLEGMASLLSQLEKSAEE
YEPEVELQVTMTKSEKGSLGFTVTKGNDNVGCYIHDIVQDPAKSDGRLQPGDRLIKVNDI
DVTNMSHTDAVSFLRAAPKTVRLVLGRVLELPKMPVLPHLLPDITLTCHKEELGLLLAGG
HDSIYQVVYISDILPRSAAAREESLHALDIIHYINGVSTQGMTLKEAKRTLETSLPWVVL
KVTRDGHPVLPKSRSPDSSDSWSKKANGKISMVTLHEPAQSWYRSFCYQGGEVFSSSSYP
LKKKCQTLGVKGKNIILHYSILETEVPDDEYYDEDDHNEVVQYLLDVVDEEAQNLLNRNN
ATSHSDFSAPVEMNGKLAEDKSEDTDCDGSSLPEDFSEPMHINGCEDHGEEGAVPERSPP
QPPSSQADEDEITWGSDELPIESISQECVNKDLPLVTNEEISTLRAVSVLPGGKYCGAKL
KAAIRVLRGLLEQGVPSKEIENLQELKPLDQCLIGQAKENRRKNRYKNILPYDTTRVPLG
SEGGYINASFIRMPVGNEEFVYIACQGPLPTTVADFWQMVWEQNCTVIAMMTQEVEGEKI
KCQRYWPDVLHKTTMITDRLRLALVRFQQLKGFIIRVLELEEIQTGEVRHISHLNFTAWP
DHDTPSQPDDLLTFISYMRHVHRSGPIVTHCSAGIGRSGTLICIDVVLGLISRDLDFDIS
DLVRTMRLQRHGMVQTEDQYIFCYQVVLYVLNHLQHEEESQCYQSPFLQ
Download sequence
Identical sequences G1N701
ENSMGAP00000007932 ENSMGAP00000007932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]