SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008039 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008039
Domain Number 1 Region: 526-757
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-35
Family Ras GEF 0.0089
Further Details:      
 
Domain Number 2 Region: 142-258
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-25
Family SH2 domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008039   Gene: ENSMGAG00000007855   Transcript: ENSMGAT00000008828
Sequence length 820
Comment pep:novel chromosome:UMD2:10:14440382:14481027:1 gene:ENSMGAG00000007855 transcript:ENSMGAT00000008828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAAGKFASLPRNVSVNHQFSLASSMDLLTTKPSLTENHSDSFQDISIHGTLPRRKKGTV
KVRACDMFSHVGMLPYTRTQRQQPPFVQDVIEEYPLQNGKSSKLHTRDQNVPDPTLEYVK
FSKERQVMDNSPEKLKKELEEELQLSSEDLRSHAWYYGRIPRQVAEDLVQRDGDFLIRDS
LSCPGSFVLTCQWKNTSQHFKINRKVLRLSEAYCRVQYQFELESFDSIPGLVRYYVGNRT
PISKQSGAIIFQPINRTVPLRCLEEKYGVTPDRQKEQSIPEGKTQTVKRLSLGIPSMQSQ
EQSIPRGNLLRNKEKSGSQPASLDHVLDKRFPLKTHQSESYLLIGSRHSSRLPEADADSC
PSSAAFRTGSEPSLSPTVVQKVTYDSQVGEALRGSDSQLYPKPPPKPSKATLLKAPDSPT
ASLSSEGHYCELSLARDSAATKQHLCQKNSYVEHLTQKERGTQSFRNSETSYLILDDGHT
ANSAGPLDVSTETAEENNVFSAPLFETLSSFKPNDFESKLLPSENKPLETSMLRKIKEIF
TKNNPKVIAQHILRMDCKVARILEVSEEMRRIMGVNSGLELITLPYGHQLRLDLIERHNT
MAIGIAVDILGCTGNLEDRAATLNKIIQVAVELKDSLGDLYAFSAIMKALEMPQVTRLEQ
TWTSLRHHYTQTAIMYEKQLKPFSKALHEGQEMVSVPQNLTLPLLMPLVTLMERQAVIFE
GMDLWESSDQSCEIMFKHLTTARQIAQNAEMYSLTAQRMLEGFQPDEEMSEIFKTEFQMR
LLWGSKGAQVNQNERYEKFSQILTALSRKLEPPPVKQVEQ
Download sequence
Identical sequences G1N781
ENSMGAP00000008039 ENSMGAP00000008039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]