SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008046 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008046
Domain Number 1 Region: 254-499
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 6.8e-65
Family Cryptochrome/photolyase FAD-binding domain 0.00078
Further Details:      
 
Domain Number 2 Region: 69-258
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.53e-49
Family Cryptochrome/photolyase, N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008046   Gene: ENSMGAG00000007888   Transcript: ENSMGAT00000008835
Sequence length 503
Comment pep:novel chromosome:UMD2:11:14953465:14956357:1 gene:ENSMGAG00000007888 transcript:ENSMGAT00000008835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGSGKGRKERDAGREKEEAEAGAVGSLEAAVREARSRAAPSVRDFRYNKQRARLVSRG
SELKEGAECILYWMCRDQRVQDNWAFLYAQRLALKQELPLRVCFCLVPTFLDATIRHYGF
MLRGLREVAEECAELDIPFHLLLGCPKDVLPSFVVEHSVGGLVTDFCPLRVPRQWVEEVK
ERLPEDVPFAQVDAHNIVPCWVTSPKQEYSARTIRAKIHSKLPEFLTEFPPVIRHPHPPP
NPPEPIAWDACYSSLQVDHTVTEVAWATPGTAAGLAMLQSFITKRLKSFGSQRNDPNKAA
LSNLSPWFHFGQVSTQRAILEVQKHRCAYKESVDAFVEEAVVRRELAENFCYYNENYDSV
RGAYDWAQSTLKLHAKDKRPFLYELPQLEQATTHDPLWNAAQLQMVQEGKMHGFLRMYWA
KKILEWTRSPEEALQFAIYLNDRYELDGMDPNGYVGCLWSICGIHDQGWKERDVFGKIRY
MNYAGCKRKFDVDQFESRYTHCK
Download sequence
Identical sequences G1N787
ENSMGAP00000008046 XP_003209191.1.16129 ENSMGAP00000008046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]