SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008117 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008117
Domain Number 1 Region: 10-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.85e-75
Family FCH domain 0.0000000271
Further Details:      
 
Domain Number 2 Region: 468-540
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008117   Gene: ENSMGAG00000007893   Transcript: ENSMGAT00000008906
Sequence length 554
Comment pep:novel chromosome:UMD2:10:14485423:14539973:-1 gene:ENSMGAG00000007893 transcript:ENSMGAT00000008906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADEGTELWDQFDNLDKHTQWGIDFLEKYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSK
DEEPSFLISVSSKYFKIVNMELNDYAGQREVVAEEMGHRVYGELMRYSHDLKTERKMHLQ
EGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNL
RTHMADENKNEYAAQLQNFNGEQHKHYYIVIPQIYKQLQEMDERRTIKLSECYKGFADSE
RKVIPIISKCLEGMILAAKSVDEHRDSQLVIDCFKSGFEPPGDFPFEDYSQNIYRTISDG
TISTPKQEGMRIDSKTTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKKLQQRIDELN
RELQKETDQKDALIKMRDVYEKNPQMGDPSSLQPKLAETMSNMDRLRMEIHKNEAWLSEV
EGKVAARTDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHAHPNEFDDEFEDDD
PLPAIGHCKAIYPFDGHNEGTLAMKEGEILYIIEEDKGDGWTRARRQNGEEGYVPTSYID
VTLEKNSKGAVTYI
Download sequence
Identical sequences G1N7D9
ENSMGAP00000008117 ENSMGAP00000008117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]