SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008155 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008155
Domain Number 1 Region: 427-521
Classification Level Classification E-value
Superfamily E set domains 2.52e-17
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 2 Region: 519-609
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000467
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 3 Region: 3-65
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000000589
Family Sema domain 0.013
Further Details:      
 
Domain Number 4 Region: 70-122
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000759
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 609-653,687-739
Classification Level Classification E-value
Superfamily E set domains 0.000000028
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008155   Gene: ENSMGAG00000016626   Transcript: ENSMGAT00000008944
Sequence length 767
Comment pep:novel chromosome:UMD2:14:11875347:11892700:1 gene:ENSMGAG00000016626 transcript:ENSMGAT00000008944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTLYAYPCGSDHTPSPMASRVPLEAAPLLETTESRLTAVAVNVEDGHTIAFLGDSRGRLH
KVLKVPILECSLYSDCESCLALKDPYCGWCVLQGRCSRRSECLRSGLSEQWLWSFNSTQQ
CLSVQSLTPANISREEKRNIFLAISDLPSLHEEEFYSCYFQDYESSAVLTESGIMCPSPD
PNQTPALPAGADHVTIKLVVRFHDIFIASVDFSFYDCAAVALLWKSAPCQKCVSSPWGCN
WCVQQHLCTHKAACEEGTIIYNERNEELSWGPGACPCVQGIQGSSLFPVNVARKITLLGK
NFHLYRDQQWDYECVLNLEGKMMMMDAYVEGDEANQSLCYITCQLNQYSYTAPQLEFNAV
VFVQRRQHLRVDSAADLHVTFYNCSVGHTDCSRCQTADSKYNCVWCGGDKPSCIFRGSCK
EEIEDLCPAPLIHSVYPLSGPVEGGTRITITGSNLGQKHQDIAETVTVAGIPCAVDAQEY
EISSSIVCVTGGSWTERFGHIVVEVPGGGRGVSEHIFTYQNPELKSIVPTQGPKAGGTCL
TLLGSKLLTGHPNEISVLLGDLPCHILSEMTEDQLACQTSPSNVSTELPVTIKYGDQERR
LEGSLFRYTLDPNITFAEPPKSFLSGGRVLRVHGYNLDVVQSPKIRVTVSPSERRRRAKS
WPNESNVCQGCSIFSCSPAACLEMCNCGEPCLVNSSYLILCKTPAINLLLRSVHIKLEFI
LDNLSFDFNSLHPMPFSYEVNPILKPLNAEDPAKPYRHKPGSVISVE
Download sequence
Identical sequences G1N7G7
ENSMGAP00000008155 ENSMGAP00000008155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]