SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008242 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008242
Domain Number 1 Region: 51-250
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000826
Further Details:      
 
Domain Number 2 Region: 18-55
Classification Level Classification E-value
Superfamily PH domain-like 0.00000153
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008242   Gene: ENSMGAG00000008058   Transcript: ENSMGAT00000009032
Sequence length 611
Comment pep:novel chromosome:UMD2:8:20463039:20500722:-1 gene:ENSMGAG00000008058 transcript:ENSMGAT00000009032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFMFYLSGGAGDREKMPVNHEAFLLMANSQNEMEDWVKAIRRVIWAPFGGGIFGQRLEDT
VQYERKYGQRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVKDLQDDSFDCGEKPLFD
SNTDVHTVASLLKLYLRELPEPVIPFAKYEDFLSCGQLLSKDEGEGTQELVKQVKNLPQA
NYNLLKYICKFLDEVQAHSSVNKMSVQNLATVFGPNILRPKMEDPVTMMEGTSLVQHLMT
VLISEQGRIFAVPQADVPGSQLEIRPMRPRNTVEWISEEDGEDSRSESNVPSPADLPSDN
AVALEAMSGPVLKNTPPEHSSKLAQPATSPSKRVQTLPPWKYSFRQQGARSVSPKLGSSS
LDIPNLSSSGNWLMNGLYSLRGHRRTASGERVKDSCSSQRLSTYDNVPSSSLSLSTHSMG
STTWSTSSCEISVVDSVSSCPACRASDSSVLSSLQTEWMTQGSLSQSEVKTADLENSIDR
LEACSSSSEHSNLAPASRDSVRCSRALQSLVVELKTELSKQRTEYETSIKRIEEASADLR
KQVVRLEEELDQERKKYTMLEIKLRNSERAREDAEKRNHLLQKEMEEFFSTLGCLTDFRL
PRKRGHTFYPQ
Download sequence
Identical sequences G1N7N8
ENSMGAP00000008242 ENSMGAP00000008242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]