SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008367 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008367
Domain Number 1 Region: 320-482
Classification Level Classification E-value
Superfamily VPS9 domain 3.27e-25
Family VPS9 domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008367   Gene: ENSMGAG00000008178   Transcript: ENSMGAT00000009163
Sequence length 482
Comment pep:novel chromosome:UMD2:13:18882619:18887466:-1 gene:ENSMGAG00000008178 transcript:ENSMGAT00000009163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEAYVEYLKSITLISQALQDEAVLTAEDSEGLGPNTPKMLKLAEQCLERVKSLAATLGEA
KNKQGKTERAGGPAPISRHRRVFSDEGGKLSPFLPPEIFQKLQIAEAQSARKELTPLEEA
SLQNQKLKAAYEARVARLNPSQALQKTSLTLSLQRQMMENLVIARAREETLQRKMEERRL
RLQEAANRRFSSSVALTPEEQEQRELYAAILEYEQDHDWPRQWKARMKRSPSDLSLVTGL
FSCLLSFPEHPIAQLLRKLQCAVYTRLYPAVSQSNPEATPARPHPALPSSHWMPGGLLPA
ELSCVTPPFPDRLLSLTLLAFEGLSTAAGKDQCLACIEDAFFPPLWAPLLALYRSVHRPQ
EEALARSMERHRHASPADLGLSPRLFPTAPGRLAYGAAIEELCLIPLETCPRRKLDCIVR
ALRSICECAEEYCSTRDSRAATAGTIDARGSGADELLPLLSYAVLRSALPQLLSECAALE
EF
Download sequence
Identical sequences G1N7Z0
ENSMGAP00000008367 ENSMGAP00000008367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]