SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008403 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008403
Domain Number 1 Region: 24-459
Classification Level Classification E-value
Superfamily Sema domain 1.2e-117
Family Sema domain 0.00015
Further Details:      
 
Domain Number 2 Region: 461-513
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000419
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008403   Gene: ENSMGAG00000008148   Transcript: ENSMGAT00000009199
Sequence length 609
Comment pep:novel chromosome:UMD2:1:20982243:20996619:-1 gene:ENSMGAG00000008148 transcript:ENSMGAT00000009199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALWIWTLSIVSCFCITFSRSEELKFFQSATELNHLTVDNDTGIIYLGVVNALYQLTENL
VVRIHVETGPRKDNKKCTPPIEENQCKEAVLTDNYNKLLLLNKENKTIVVCGSLFKGICA
TRDLENITKVTHYVETSGEKSFVASNDENVSTVGLITSLDNDQVLFVGKGNGPNDNGIII
STRQLHEKDGKDIFEMYSDSAAVKSAYHSSSTQQFVTVFEDKNYVYFIFNQQEKQPVNNR
TLIARLCKDDAHYYSYFEMDLGCKDEDGSYDHCHSAYVTTPDSASDDKVLVALFSKVNKD
NGSLKSAMCVFSLRHINEKMEKNRDDCYTNKNTSMFYKLFAVENPCGPHGQNASKNFPCG
SEHLPYLLGSKNGVIEKPVLQKEGMNLTAVTVTVENGHTVAFLGTSDGKILKVFLSSTVT
EYSSLTIELNKPIKNDLVLDKTQAYLYVMTTDKVHRLPVQQCHKYSDCEKCTQAQDPYCG
WCVREGRCTKRADCEMADKENDWLWSPSGTCMTIISADPQNMSRRAPAKVKLTVSPLPTL
STSDKLWCTFGETSHRAQLNEGVIICDPPDMIPPTPKGQDHVSVPLQLTFGENKIFFASH
TYPFYDCEE
Download sequence
Identical sequences G1N819
ENSMGAP00000008403 ENSMGAP00000008403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]