SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008412 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008412
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008412   Gene: ENSMGAG00000008229   Transcript: ENSMGAT00000009209
Sequence length 171
Comment pep:novel scaffold:UMD2:GL427461.1:119:1708:-1 gene:ENSMGAG00000008229 transcript:ENSMGAT00000009209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSCHPSGLDIDGLYRVSGNLATIQKLRYKVDHEEHLDLDDGRWEDVHVITGALKLFFREL
PEPLVPFGHFDKFIAAIKMQDPVRKGRCVRDLVRSLPPANHDTMKVLFGHLCRVIEFKEE
NRMSVQSIAIVFGPTLLRAPSEEGSMAVHMVFQNQVVELILNQYGHIFPDG
Download sequence
Identical sequences H9H1D7
ENSMGAP00000008412 ENSMGAP00000008412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]