SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008563 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008563
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000272
Further Details:      
 
Domain Number 2 Region: 172-243
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.27e-27
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000686
Further Details:      
 
Domain Number 3 Region: 346-455
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.48e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008563   Gene: ENSMGAG00000008344   Transcript: ENSMGAT00000009362
Sequence length 467
Comment pep:novel chromosome:UMD2:1:22673962:22694654:1 gene:ENSMGAG00000008344 transcript:ENSMGAT00000009362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSAVVQIYAADRNGMWSKKCCGVACLVKDNPQRSYFIRIYDIKDGKLLWEQELYNNFV
YNSPRGYFHTFAGDTCQVGLNFANEEEAKLFRKTVTDLLGRRQRKSEKRRDPPNGPNLPM
ATVDIKNPEITTNRFYTPQVNNISYTKEKKKGKTKKRRLTKADIGTPSNFQVHIGHVGWD
PNTGFDVNNLDPELKNLFDLCGISEAQLKDKETSKAIYDFIEKTGGVEAVKNELRRQGPP
RWSVVVSSDVTELPTLHSATPPSSLQLSPGKPSENKAKLPEPLPSVLQCGQPVLFSEHAT
GQKNDLPLIPGLVKLVHAQRSLQKTKSNPFFLLLPVSERLESINPGPPPPPGLPSEVDHQ
LPVPAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESAP
PTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWDD
Download sequence
Identical sequences G1N8D6
ENSMGAP00000008563 ENSMGAP00000008563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]