SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008763 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008763
Domain Number 1 Region: 1248-1464
Classification Level Classification E-value
Superfamily VPS9 domain 3.27e-53
Family VPS9 domain 0.00014
Further Details:      
 
Domain Number 2 Region: 95-453
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-47
Family p120GAP domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008763   Gene: ENSMGAG00000008525   Transcript: ENSMGAT00000009566
Sequence length 1467
Comment pep:novel chromosome:UMD2:19:9643153:9663392:1 gene:ENSMGAG00000008525 transcript:ENSMGAT00000009566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWISKQQRINLDRLII
TSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLNRLRENPRLIASCLVAGEKL
NQDNTQSVIHTVFTSIYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSI
LFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPVQQEKLFGEKGT
EKFKQRVQEMVDSNEAKLVTLVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVG
EVRAMCTDLLLACFICPAIVNPEQYGIISDAPINEVARFNLMQVGRLLQQLAMTGSEEGD
PRMKSNLAKFDKSCVAAFLDVVIDGRAVETPPMSSVNLLEGLSRTVVYMTYSQLTTLVGF
MRNVMLSDQLKEDRMALENLLANLPQNKPGKSSSLEMTPYNTPQLSPATTPANKKNRLPI
ATRSRSRSNILMDQHGDHEGSSQETIPEVQPEEVLVISLGAGPQITPGMMSENEVLNMQL
ADGGQGDVPVDENKLHGKPDKTLRFSLCSDNLEGISEENELFILRGPSNRSNSVSSLDLE
GESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVS
ETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLLDPCTGSTISETTS
EAWSVEVLPSDSEAPDLKQEERLQELESCSGLGSTSDDTDVREVSSRPSTPGLSVVSGIS
ATSEDIPNKIEDLRSECSSDFGGKDSVTSPDMDETAHGASQLTSPPSQTDSLLALFDPLS
SNEGVSAVVRPKVHYARPSHPPPDPPILEGAVGGNEARLPNFGSHTLIPTDLEAFKQRHS
YPERLVRSRSSDIVSSVRRPMSDPGWNRRPGNEERELPMPATGTAVLMATSQSSSSSPSK
DSSRGEIDERKDSDDEKSDRNKPWWRKRFVSAMPKAPIPFRKKEKQEKDKDDMVPDRYST
LQDDPSPRLSAQAQAAEDILDKYRNAIKRTSPSEGALVNYDSGETTGDGESVHDSPRDEA
LQNMSADDLPDSASQVAQPQSSAFSYRDAKKKLRLALCSADSVAFPMLTHSTRNGLPDHT
DPEDNEIVCFLKVQLAEAINLQDKNLMAQLQETMRCVSRFDNRTCRKLLASIAEDYRKRA
PYIAYLTRCRQGLQTTQAHLERLLQRVLRDKEVANRYFTTVCVRLLLESKEKKIREFIQD
FQKLTAADDKTAQVEDFLQFLYGAMAQDAIWQNASEEQLQDAQLAIERSVMNRIFKLAFY
PNQDGDILRDQVLHEHIQRLSKVVTANHKALQIPEVYLREAPWPSAQSEIRTISAYKTPR
DKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCLLSTVQYISSFYAN
CLSGEESYWWMQFTAAVEFIKTIDDRK
Download sequence
Identical sequences G1N8T5
ENSMGAP00000008763 ENSMGAP00000008763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]