SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008799 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008799
Domain Number 1 Region: 12-173
Classification Level Classification E-value
Superfamily E set domains 3.08e-55
Family RhoGDI-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008799   Gene: ENSMGAG00000008574   Transcript: ENSMGAT00000009603
Sequence length 177
Comment pep:novel chromosome:UMD2:17:9635053:9637094:-1 gene:ENSMGAG00000008574 transcript:ENSMGAT00000009603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPCFLPDYLCKPEDNIYNIDFTRFKIRDLETGTVLFEIAKPSAAEQDNEDEDDSSELDS
SAGRFVRYQFTPAFLRLRTVGATVEFTVGEKPVSNFRMIERHYFRDRLLKNFDFDFGFCI
PSSRNTCEHIYEFPQLSEDLIRLMVENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ
Download sequence
Identical sequences G1N8W1
ENSMGAP00000008799 ENSMGAP00000008799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]