SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008858 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008858
Domain Number 1 Region: 136-290
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.12e-46
Family CRAL/TRIO domain 0.0000453
Further Details:      
 
Domain Number 2 Region: 40-133
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.09e-18
Family CRAL/TRIO N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008858   Gene: ENSMGAG00000008615   Transcript: ENSMGAT00000009665
Sequence length 290
Comment pep:novel chromosome:UMD2:12:12900222:12903022:1 gene:ENSMGAG00000008615 transcript:ENSMGAT00000009665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVTGTFRIVSEEEQALRTKLERLTTKDHGPVFGRCQQIPPHTLQKAKDELNETEEQRE
AAVRALRELVQERAGSEDVCKAVAEKVQGKDDSFFLRFIRARKFDVHRAYDLLKGYVNFR
QQYPELFDNLTPEAVRSTIEAGYPGILASRDKYGRVVMLFNIENWDYEEITFDEILRAYC
VILEKLLENEETQINGFCIIENFKGFTMQQASGIKPSELKKMVDMLQDSFPARFKAVHFI
HQPWYFTTTYNVVKPFLKSKLLERVFVHGEELESFYQEIDADILPADFGG
Download sequence
Identical sequences G1N912
ENSMGAP00000008858 ENSMGAP00000008858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]