SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008870 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008870
Domain Number 1 Region: 226-406
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.93e-26
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 521-630
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000131
Family Second domain of FERM 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000008870
Domain Number - Region: 422-513
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0961
Family Ras-binding domain, RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008870   Gene: ENSMGAG00000008626   Transcript: ENSMGAT00000009678
Sequence length 736
Comment pep:novel chromosome:UMD2:6:22749854:22765378:-1 gene:ENSMGAG00000008626 transcript:ENSMGAT00000009678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIGNAYVAVIRPKNTASLNSREYRAKSYEILLLEVPIEGQKKKRKKVLLETKLQG
GTEITQSILDYVLEATKPISPANQGIKGKRVVLMKTFPLDGERAGQEASLYIVPTVVKDN
TKYTYSPGCPVFYCFQDIMRVCSESSTHFATLTARMLIALDKWLDERHTQSHSIPALFRP
SPLERIKTNVINPAYAIEPGQTESSLHMGYTALEIKSKMLALEKADMCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKREKWQRSMSSVTEDKEHQWVDDFPLHRSACEGD
SDLLSHLLDKKFSVNQLDSDHWAPIHYACWYGKVEATRMLLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQGRSPLNVCEENKQNEWEETAKLLKDAVNKPYE
KARIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPFHKP
LQHIRDWPEIFTELTNLDPQRETSQLFLRRDVRLPLEIEKKIEDPLAILILFDEARYNLL
KGFYTSPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASSSSHKVIKVYV
GVNVKGLHLLNMETKALLLSLKYGCFMWQLGDGDTCFQIHSLENKMSFIVHTKQAGLIVK
LLMKLNGQLMPSERNE
Download sequence
Identical sequences G1N921
XP_010710883.1.16129 ENSMGAP00000008870 ENSMGAP00000008870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]