SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008876 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008876
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.89e-68
Family BAR domain 0.00048
Further Details:      
 
Domain Number 2 Region: 221-253,285-342
Classification Level Classification E-value
Superfamily SH3-domain 4.96e-18
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008876   Gene: ENSMGAG00000008633   Transcript: ENSMGAT00000009685
Sequence length 343
Comment pep:known chromosome:UMD2:10:16669114:16681256:-1 gene:ENSMGAG00000008633 transcript:ENSMGAT00000009685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFTEEKLGQAEKTELDAHLENLLSKAECTKQWTEKIMKQTEVLLQPNPNARIEEFFYEKL
DRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNALIKCGETQKQIGTADRELIQTSAINF
LTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKTRLKKAKVAEARAASEQEVRITQSEFD
RQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYKYMLDLQKQLGSFPSTFLSNN
NQSSSAPVQSVSTPSVLASASASLPSVSNSVVTSGISELKSSSGSRKARVLYDYDAANSS
ELSLLADEVITVYSIPGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences G1N926
ENSMGAP00000008876 ENSMGAP00000008876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]