SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008973 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008973
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily PX domain 5.36e-23
Family PX domain 0.0016
Further Details:      
 
Domain Number 2 Region: 157-318
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.24e-22
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008973   Gene: ENSMGAG00000008724   Transcript: ENSMGAT00000009785
Sequence length 360
Comment pep:novel chromosome:UMD2:14:12375964:12387385:1 gene:ENSMGAG00000008724 transcript:ENSMGAT00000009785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYIIRVQRGVSAENSWQIVRRYSDFDLLNNSLQISSLSLPLPPKKLIGNMEREFIAERQK
GLQAYLDVITSHHILSNCELVKKFLDPNSYSVNYTEIALQHVSMFFRSEPKWEVVEPLKD
IGWRIRKKYFLMKIKNQPKERLMLSWADLGPDKYLSDKDLQYAVKLLSSCSHPYIYKVTF
ATASESSALVIRPFNEKGTLKDLIYKARPKDPFLKKYCNPKKIQGLELQQIKTYGRQILE
VLKFLHEKGFPYGHLHSANVVLDGDTCKLLDLENSLLGLPSFYRSYFSQFRKINTLEGID
VHCFGHLLYEMTYGRPPDTIPVDSFPPAPSMSVVSVLESILTCEAMKNGMPTVSRLLQMP
Download sequence
Identical sequences G1N998
ENSMGAP00000008973 ENSMGAP00000008973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]