SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009108 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009108
Domain Number 1 Region: 13-202
Classification Level Classification E-value
Superfamily E set domains 8.75e-64
Family RhoGDI-like 0.000000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009108   Gene: ENSMGAG00000008858   Transcript: ENSMGAT00000009922
Sequence length 202
Comment pep:novel chromosome:UMD2:16:12683286:12684980:-1 gene:ENSMGAG00000008858 transcript:ENSMGAT00000009922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSAEPKAVLTAHLYTSDQQQRDXAYKTPERKSLREIQELTRDESLRKYKQALLGNIPVA
VDASVPNVQVTKLTLMCEQAPGPITMDLTGDLEVLQSRPFVLKEGVDYRVKVSFKVNREI
VCGLKCLHLTYRRGRPVDRDVFMVGSYAPRAEEYEVVTPAEEVPRGRLVRGSYRVRSLVT
DDDKTEHLAWEWGLCIRKGWED
Download sequence
Identical sequences G1N9L2
ENSMGAP00000009108 ENSMGAP00000009108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]