SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009255 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009255
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.33e-31
Family BAR domain 0.00000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009255   Gene: ENSMGAG00000008992   Transcript: ENSMGAT00000010072
Sequence length 99
Comment pep:novel chromosome:UMD2:Z:35054369:35055619:-1 gene:ENSMGAG00000008992 transcript:ENSMGAT00000010072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPALADVGEAMKELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKMEGRRLDFDY
KKKRQGKLPDEELRQALEKFDESKEIAESSMFNLLEMDV
Download sequence
Identical sequences G1N9W6
ENSMGAP00000009255 ENSMGAP00000009255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]