SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009325 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009325
Domain Number 1 Region: 184-328,390-426
Classification Level Classification E-value
Superfamily ARM repeat 2.04e-47
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0015
Further Details:      
 
Domain Number 2 Region: 459-748
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.61e-39
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00022
Further Details:      
 
Domain Number 3 Region: 2-82
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.33e-23
Family PLC-like (P variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009325   Gene: ENSMGAG00000009060   Transcript: ENSMGAT00000010144
Sequence length 752
Comment pep:novel chromosome:UMD2:Z:4233147:4288291:-1 gene:ENSMGAG00000009060 transcript:ENSMGAT00000010144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKV
WPNVEADGSEPTRTPGRTSSTVSEDQMSRLAKLTKSHRQGHMVKVDWLDRLTFREIEMIN
EVGKSGRNTNFCFLLINFFCIMVDIFKYNVLYVNRKDGDESSPVLTSSEIVKIPDPQMSM
ENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNVSQSYHDLKKIINKEKSVGVSHKYL
FDLSFQALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHFTNPTVRRYAVA
RLQQADDEDLLMYLLQLVQALKYENFDDIKNGLEPSKRDSQGSMSESMTTSGTNGTEIDS
SQIMTPIPSVSSPPLTSKTKEVADNENLDQDLCTFLISRACKNSTLANYLYWYVDEIMHL
KQHTSEHSIQSIRGMYTNSKVLSHLSNSRVKGDKSVRVMRSLLAAQQTFVDRLVHVMKAV
QRESGNRKKKVNKRLENLSLVYQTFSVRNQEIQLTYFVPRAKIKKLFLYKKSKFLPVLLL
RRMKNSEMPHKMQHGSKDQKFLNVPHIWQKISKPQNFLKKMTLFNFLFHSVNLNFSLFLC
VLHLADNLDYSSMSSDPLWHSACEQKLRKGTCIDAYNLLVTAGYCVITYILGVGDRHLDN
LLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLH
LRRYSNLILNLFSLMVDANIPDIALEPDKTVK
Download sequence
Identical sequences G1NA21
ENSMGAP00000009325 ENSMGAP00000009325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]