SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009586 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009586
Domain Number 1 Region: 492-610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000115
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009586   Gene: ENSMGAG00000009282   Transcript: ENSMGAT00000010415
Sequence length 704
Comment pep:novel chromosome:UMD2:7:15399949:15449766:1 gene:ENSMGAG00000009282 transcript:ENSMGAT00000010415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASVILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTSMDELSVTLDYLLSIPSEKCKA
RGFTVIVDGRKSQWNVVKTVVLMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRL
GFEIMFLNTHLEKLVQGIWKMQLLISFSVLAGRKSYNQVEWLQNKRLVFEKFTKESTSLL
DELALINNGSDKGNQQEKDRSIDLNFLPSVDPETVLQTGHELLSELQQRRFNGSDGGVSW
SPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSE
QLRTQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLVELKA
NQNRSSEASERQLSHKNIFRQNFCSVRYQHHKLLQNMSPQDKFIKIILCRVPPSPSPKGS
VKYSDLSGLSAVHHFIKAVYCILQALKLKQKGLSVYLTRKLCHPLTVESKQDIECFNHLL
MNSCIVKTLCEDMVDVRRLKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQ
ETKVLLEKHRKFVDVAQSTYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTL
TSEERVQRLETAVAFHSSAEKILQECPEQPEAFNEMDQFDEIEAVGKSLLDRLTVPVVYP
DGSEQYFGSPSDMASAAEHIREKMKLVSLKKQQLRQPEATTPES
Download sequence
Identical sequences G1NAM3
ENSMGAP00000009586 ENSMGAP00000009586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]