SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009673 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009673
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-31
Family Ubiquitin-related 0.00000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009673   Gene: ENSMGAG00000009370   Transcript: ENSMGAT00000010505
Sequence length 89
Comment pep:novel chromosome:UMD2:20:10808798:10813119:-1 gene:ENSMGAG00000009370 transcript:ENSMGAT00000010505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQP
INETDTPAQLEMEDEDTIDVFQQQTGGVY
Download sequence
Identical sequences A0A087R2U9 A0A087VKP0 A0A091GWI8 A0A091IP30 A0A091J5J4 A0A091KJB0 A0A091T857 A0A091U9Y7 A0A091WF10 A0A091X2E8 A0A093G8I3 A0A093HFU8 A0A093IID7 A0A093IWC1 A0A093JC91 A0A094MFA7 A0A099ZUQ4 A0A099ZY74 G1NAU1 G5BNC2 L8HT26 M7AZE0 U3IGN8
HGL_H00000405965-7 ENSMGAP00000009673 ENSMGAP00000009673 ENSAPLP00000006410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]