SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009715 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009715
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family PDZ domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009715   Gene: ENSMGAG00000009407   Transcript: ENSMGAT00000010547
Sequence length 239
Comment pep:novel chromosome:UMD2:10:19607837:19622534:-1 gene:ENSMGAG00000009407 transcript:ENSMGAT00000010547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAQIMFCTLNTHKVDMDKLLGAQIGLEDFIFAHIKGQRKEVEVLKSDDLLGLTVTDNGAG
CPFIKRIREGSLMDQTKMICVGDHIESINGKDVSDLRHYEVAKMLKDLEKGRVFKLKLIE
PMKSFEKVAARSKGGTLTEAKISRGRETLRLRNKGPATVEEMLSEVEEKAVKKVDELLET
YMGIRDIELAATMVEAGRDKKNPDEFAVALDETLGDFAFPDEFVFDVWGAIGDAKQGRL
Download sequence
Identical sequences G1NAX2
ENSMGAP00000009715 ENSMGAP00000009715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]