SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009892 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009892
Domain Number 1 Region: 192-280
Classification Level Classification E-value
Superfamily Immunoglobulin 6.47e-16
Family I set domains 0.08
Further Details:      
 
Domain Number 2 Region: 33-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000719
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 3 Region: 108-184
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000608
Family Pre-dockerin domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000009892
Domain Number - Region: 374-434
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00222
Family Carboxypeptidase regulatory domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009892   Gene: ENSMGAG00000009589   Transcript: ENSMGAT00000010733
Sequence length 1024
Comment pep:novel chromosome:UMD2:12:17842492:17851980:-1 gene:ENSMGAG00000009589 transcript:ENSMGAT00000010733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLEGTRSSSHRLDPIFTSARRTVLVQDSRKFLSPWSKWSECSGKCGQTGVQKRTRSCL
ADRLWGVHCNEVMEEGRLCIGHVCSGCNITCPMGRVNADCDACMCEDVTLHGKVSLEDGS
PADNARVYLQANNLKLLTTADNKGTFRIPGVCPDGRNTLKIKKAKYTTAAITVPETNRKN
LVLQVQLKRSGKPYVFKSPDDKARRVGQSVSLCCNAVGTPAPDRYLWYHNGSLLDPSIYR
YKNNLILKNLNREQAGEYFCKAISDGGSAKSQPATLSVIGKQEAACSSKPQSHLIRLPHD
CFQKATDSFYYDVGKCPAKTCVGKLDKGLRCKDNISYCCGVSKMEVREILCDGYTLPTKV
AVECGCKKCTETKITVRGRATAVDNGEPLRFGHIYMGNKRVSMTGYKGTFSIHVPPDTER
LVLTFVDRLQKFVNTTKVLPFKENGGAVFHDIKLLRKKAPVTLESTETSVIPLGEKEDDD
PIAELEIPPDSFYRKNGEPYRGKVKASVTFLDPRELSTAPVTQSDLNFVDDEGDVFPLRT
YGMFSLDFTDEQGTETLNAENVKVHLDTSQVRMPEHLEEMKLWSLNPETGLWEEEGDFNL
EKSRRRRREERTFLVGNMEIKERRLFNLDVPESRRCYVKVRAYRSERFLPSEQIQGVVIS
VINTEPEPGFSSNPRAWGRFDSVVTGPNGACVPAFCDEQNPEAYAAYILASLGGEELEAV
PSAPKLNPNAIGVPQPYLNKLNYRRTDHEDPNTKKTAFRINMAKPSPNSADENNGPIYAY
ENLKECEEAPYSAAHFRFYRIEGDRYDYNTVPFSEDDLMSWTDDYLAWWPKPMEFRACYI
KVKINGPQEVNIRSRNMGGTHPRTIGKLYGIRDVRSIRDPEQQDVSAACLEFKCSGMLFD
QDRVDRTLVKVIPQGSCRRESVNSMLHEYLVNHLPMATNNDSSEYTMLAPLDPLGHNYGI
YTVTDQDPRIAKEIALGRCFDGTSDGTSRIMKSDIGVALTFTCSERSAAEQSLFESQRNL
GQQS
Download sequence
Identical sequences G1NBA9
ENSMGAP00000009892 ENSMGAP00000009892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]