SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010029 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010029
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000109
Family PDZ domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010029   Gene: ENSMGAG00000017393   Transcript: ENSMGAT00000010873
Sequence length 68
Comment pep:novel chromosome:UMD2:14:17501125:17502572:-1 gene:ENSMGAG00000017393 transcript:ENSMGAT00000010873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGEETKALTLVLHRDSGSLGFNIIGGRPCVDNQDGSASEGIFVSKIVDTGPAAKEGGL
QIHDRIIE
Download sequence
Identical sequences G1NBK7
ENSMGAP00000010029 ENSMGAP00000010029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]