SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010192 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010192
Domain Number 1 Region: 24-91
Classification Level Classification E-value
Superfamily PDZ domain-like 3.59e-17
Family PDZ domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000010192
Domain Number - Region: 284-366
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0429
Family FCH domain 0.083
Further Details:      
 
Domain Number - Region: 197-248
Classification Level Classification E-value
Superfamily EF-hand 0.0885
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010192   Gene: ENSMGAG00000009849   Transcript: ENSMGAT00000011038
Sequence length 419
Comment pep:novel chromosome:UMD2:16:13940035:13949658:1 gene:ENSMGAG00000009849 transcript:ENSMGAT00000011038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHLLTSLPCSYSIESGIQSISIAKSSGLGLTVSGGANRPDGPMVYVQELTPDGDCYKDGR
LRPGDQLIAINRDSLVGSTLEEARKIIAKAKFRFEWHFKVAVVQRNFDSLDHLKCNTDLP
RRGRLHPGLSAHNSIPSPPPKAVGNGLSSCRLKVHVRSPEQHPIYSCGTEVTSAWKTATG
SKPKVALDPHIRLKDGKLELVLQYLGLEVTEEKKRQLRQSLTTDSQGTVAYGDLLQALRD
VMQDELDEAGLDSSSVLFTQHEVASLLDTSAFHCNGSEEMEQLQLEMTDLRQEVRRLKSL
LKEVENSKKSMEDELQRLNQKALGFLSENRTLHSKLQMAEVVQRQAHSAEQDYEEVIHLL
EAEIAELKMQLAAFSPGQEDILELKRQLSLADGQLRKSEVSRKRLEICNRKLLLFVQVM
Download sequence
Identical sequences G1NBY6
ENSMGAP00000010192 ENSMGAP00000010192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]