SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010212 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010212
Domain Number 1 Region: 701-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.14e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000549
Further Details:      
 
Domain Number 2 Region: 520-697
Classification Level Classification E-value
Superfamily ARM repeat 5.18e-63
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000237
Further Details:      
 
Domain Number 3 Region: 107-297
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.79e-48
Family Ras-binding domain, RBD 0.00078
Further Details:      
 
Domain Number 4 Region: 332-473
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.98e-42
Family PLC-like (P variant) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010212   Gene: ENSMGAG00000009828   Transcript: ENSMGAT00000011058
Sequence length 1069
Comment pep:novel chromosome:UMD2:11:17585875:17608650:-1 gene:ENSMGAG00000009828 transcript:ENSMGAT00000011058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLTIKHELFKEARKYPLY
QLLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGF
AIGMPICEFDMVKDPEVQDFRRNILNVCKEAVDLRDANAPHSRALYVCPPNVESSPELPK
HIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQL
KLCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPL
DTFTMPSYSRRISTATPYMNGEATAKSLWTINSALRIRILCATYVNVNIRDIDKIYVRTG
IYHGGEPLCDNVNTQRVPCSNPRWNEWLLYDMYIPDLPRAARLCLSICSVKGRKGAKEEH
CPLAWGNINMFDYTDTLVSGKMALNLWAVPHGLEDLLNPIGVTGSNPNKETPCLELEFDW
FSNPVKFPDMTVIEEHANWTISRELGFNYSYAGLSNRIARDNELRESDKEQLRAICTRDP
LSEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAM
ELLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNQLVRFLLKKALT
NQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDIL
KQEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPL
WLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCL
SIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDAAIDLFTR
SCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDI
AYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Download sequence
Identical sequences G1NC03
ENSMGAP00000010212 ENSMGAP00000010212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]