SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010427 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010427
Domain Number 1 Region: 75-189
Classification Level Classification E-value
Superfamily EF-hand 1.71e-24
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 2 Region: 169-239
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.41e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 3 Region: 242-306
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000538
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010427   Gene: ENSMGAG00000010034   Transcript: ENSMGAT00000011285
Sequence length 379
Comment pep:novel chromosome:UMD2:6:28300798:28359957:-1 gene:ENSMGAG00000010034 transcript:ENSMGAT00000011285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIDLEGFKLFMKTFLEAELPDDFIEHLFTSFSNKISHCSPLIKNKPPLLSGGLRLNKGTS
TSRPPTPANLNLPDAIQLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGYLDSSELENI
IAQMMHVAEYLEWDITELSPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLEN
NVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVSRAPASCIKT
YVKSKKNTDVMHHFWVEGNCPTKCDKCHKTIKCYQGLTGLHCVWCQITLHNKCASHLKPE
CDCGPLKDHILPPTSICPVVLTLPTLGGLLPEERQATVKKEKGCPQQMNKLGERNKMQRA
NSITVDGQGLQVLPTKFRV
Download sequence
Identical sequences G1NCF7
ENSMGAP00000010427 ENSMGAP00000010427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]