SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010476 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010476
Domain Number 1 Region: 285-473,784-931
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.35e-115
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000654
Further Details:      
 
Domain Number 2 Region: 6-119
Classification Level Classification E-value
Superfamily DUSP-like 1.23e-37
Family DUSP, domain in ubiquitin-specific proteases 0.000000449
Further Details:      
 
Domain Number 3 Region: 146-217
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000108
Family UBX domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010476   Gene: ENSMGAG00000010065   Transcript: ENSMGAT00000011334
Sequence length 981
Comment pep:novel chromosome:UMD2:1:34586486:34658549:1 gene:ENSMGAG00000010065 transcript:ENSMGAT00000011334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGAADLETQRTDVAALLKTALRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDSQSLKEHLIDELDYILLPTEGWNRLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPGEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGSSTPKSPGASNFSTLPK
ISPSLSNNYNNMNNRNVKNSNYCLSSYTAYKNYDYSEPGRHNEQPGLCGLSNLGNTCFMN
SAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPRA
FKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEE
AWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVFLV
RMDPLAKPMQYKVVVPKIGNILDLCTALSALSGVAADKMIVTDIYNHRFHRIFAMDENLS
SIMERDDIYVFEIAINRTEDTEQVIIPVCLREKCRHTSYSHSGSSLFGQPFLIAVPRNNT
EDKLYNLLLLRMCRYVKTCTETDDTEGSLRCCKEHGINGNGPNGIHEEGSPSEMETDEQD
DESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQPLTGHKKRLFTFQFNNLGN
TDINYIKDDTRHIRFDDRQPRLDERSFLALDWDPELKKRYFDDSAAEDFEKHESVEYKPP
KKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYS
RYMRDKLDTLVGFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDD
GKWYYFDDSSVSIACEDQIVSKAAYVLFYQRQDTISGTGFFPLDRETKQGASAATGIPLE
SDEDSNENDNDIENENCMHTN
Download sequence
Identical sequences G1NCJ5
ENSMGAP00000010476 ENSMGAP00000010476 XP_003202087.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]