SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010551 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010551
Domain Number 1 Region: 95-182
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000439
Family PDZ domain 0.076
Further Details:      
 
Domain Number 2 Region: 20-87
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000586
Family HtrA-like serine proteases 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010551   Gene: ENSMGAG00000010179   Transcript: ENSMGAT00000011410
Sequence length 442
Comment pep:novel chromosome:UMD2:7:18936084:18944076:1 gene:ENSMGAG00000010179 transcript:ENSMGAT00000011410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQQTNDLSGGGCRTAHVPWLVLVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLL
KANVEKPVKMLVYSSKTLELRETSVTPSNMWGGQGLLGVSIRFCSFDGANENVWHVLEVE
PNSPAALAGLRPHSDYIIGADTVMNETEDLFSLIETHEAKPLKLYVYNTDTDNCREVVIT
PNSAWGGEGSLGCGIGYGYLHRIPTRPFEEGKKISLPGQLPSASLSPLKDGFTEVQLSSV
NPSPPLPPGPAGLEQSLSGLSISSPSTTVSNVLSTAGVPTVPLLPPQVSQSLTSVPPVNP
ATTLPGLMPLPAGLPNLTDLSKLNLPAPHIVPEMVQPGMPTLPSLPPLNLMGITPPLMPP
KCVPLLPLVTEVSTVPTDLLPTMTQAGSFSVDPGTTVNVEQTSPLTLDSASPTSKATIDR
SNESSAVNEKASGITDTHASES
Download sequence
Identical sequences G1NCQ4
ENSMGAP00000010551 ENSMGAP00000010551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]