SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010557 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010557
Domain Number 1 Region: 23-186,213-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-63
Family FCH domain 0.002
Further Details:      
 
Domain Number 2 Region: 486-671
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.35e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000799
Further Details:      
 
Domain Number 3 Region: 723-782
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010557   Gene: ENSMGAG00000010168   Transcript: ENSMGAT00000011416
Sequence length 1064
Comment pep:novel chromosome:UMD2:1:35212711:35284283:1 gene:ENSMGAG00000010168 transcript:ENSMGAT00000011416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTPPQAFSSKPDVLLMPEAGRGNIRAQLIEQQKCLEQQTEMRVQLLQDLQDFFRKKSEIE
MEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEDRHQRRSSVKKIEKMKEKRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDSLEPRSDKQRFMEMFPTAFCPPMKFEFQSHMGDEVCQVTAQQPVQAELMLRYQ
QLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKFREYLEGSNLITKLQAKHDLLQRALGEGHRAEYMTTSR
GRRNSHARHQDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENP
LADDQSNHDINSVAGVLKLYFRGLENPVFPKERFNDLISCIRIDNLYERALHIRKLLLTL
PRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPDIQDQVSCQAHVNEII
KTIIIHHEAIFPDAKELDGPVYEKCMAGDDYCDSPYSEHGTLEEVDQDASTEPHTSEDEC
EPIEAIAKFDYIGRSARELSFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVVQDMD
DTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRHSDVYLGRQRKRSEPPPPLRRPGR
SSDGHCPVHPPHPLSSSSVDLGSPNLATHCSPRALLQNRNLNADSPERRRRPGHGSLTNI
SRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPESIAQDIEETMNTALNELRELERQSS
AKHAPDVVLDTLEQMKNSPTPATSTESLSPLHSVVLRSSEPQIRRSTSSSSDTMSTFKPM
VAPRMGVQLKPPALRPKPIVLPKTNPSIGPSPPSQGPADKSCTM
Download sequence
Identical sequences G1NCQ8
ENSMGAP00000010557 ENSMGAP00000010557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]