SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010602 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010602
Domain Number 1 Region: 373-519
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-25
Family Regulator of G-protein signaling, RGS 0.0024
Further Details:      
 
Domain Number 2 Region: 562-677
Classification Level Classification E-value
Superfamily PX domain 5.36e-24
Family PX domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010602   Gene: ENSMGAG00000010193   Transcript: ENSMGAT00000011463
Sequence length 959
Comment pep:novel chromosome:UMD2:6:29752475:29794888:-1 gene:ENSMGAG00000010193 transcript:ENSMGAT00000011463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCLQTSLSIWGWGSLGVVLFLITFGPFAIFYFAFYILCFVGGGFVVTLLFGKSNSEKYLE
QCEHSFLPCTSVGIPKCIEEMKREARPIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWY
YTLSDDESFLLEIRQALQYALVQFSARSKETDWQPYFTTRLVDDFGTHLRVFRKAQQRIA
EKGDQMKDQAEELVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYILLPPGD
FQNKIMRYFVREILSRGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNI
GELEAVKDKASEELQYLRSLDTAGDVSDINTIKNQINSLLYVIKVCDSRIQRLQSGKEID
TVKLAANFGKLCTVPLDHILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLE
VLQSRQRDGKHQTNQTKGLLRAAAVGVYEQYLSEKASPRVNIDDNLVAKLAETLNHEDPT
PEIFDDIQRKVYELMLRDERFYPSFKQNVLYVRMLAELDMLKDPSFRGSDDGEGESFNGS
PTSSINLSLDDLSNVPSDETVQLHAYISDTGVCNDHGKTYALYAITVHRRNANSEETWKT
YRRYSDFHDFHMRITEQFENLANILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLNPEM
MKASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGM
TKMSDNMGKMSERLGQDIKQSFFKVPPLIQKTYSDPDHCRVAATIDDSVDDNIPLRVMLL
LMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADAVKRFR
DAFWPNGILAETVPRRDKAIRMRTRVAGKTKLLEIMPDELKHIIGAETTRKGILRVFEMF
QHTQLNKRMVYVFLERFLETLFPQNKFHELFNKLHSRSKQMQRYKQRLHSTQAPSLQKR
Download sequence
Identical sequences G1NCU0
ENSMGAP00000010602 ENSMGAP00000010602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]