SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010619 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010619
Domain Number 1 Region: 10-307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-55
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000010619
Domain Number - Region: 302-360
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000223
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010619   Gene: ENSMGAG00000010232   Transcript: ENSMGAT00000011480
Sequence length 730
Comment pep:novel chromosome:UMD2:1:35343299:35365335:1 gene:ENSMGAG00000010232 transcript:ENSMGAT00000011480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTSNYLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNSISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLVMEFCPCGSLYTVLEEPSNAFGLPESEFLIVLRDVV
KVAGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEE
YLHPDMYERAVLRKEHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKII
TGKPSGAVSGIQKAANGPIEWSWEMPISCSLSKGLQVLLTPVLANILEADQEKCWGFDQF
AETSDILHRIIIHIFSLQQMTLHKVYIHSYNTATIFHELVYKQTKIPSQNQELIYEGRRL
ILEPGRLAQHFPRTTEENPIFVVSREAVNIVGLVYEEVLLPKVHQRYDLDGDASMAKEVT
RIVCYACRVANSLLLYQELMRKGIRWLNEIIKDDYNEMVHKKTEIVIRLDFCSRNIEKAE
KIYENLMQINLESSEVDEIPEINTKLLRLSSSQGTIETSLQDIKTKLSPGGLLADTWANQ
EGTHPRDRNSERLQTLLSSITEIYYQFKKDKQERRLPYNEEQIHKFDKQKLYLHATKAIA
LFKDECVSKYDAFLDKAEDWTRKMLHTRKQLLALTKQCFDIEEEVSKYQDYINELQDALR
QKMFAAFTGMKHTMNTVYPSSNTLVEMTLGMKKLKKEMEGVVKELAENNHILERFGALTA
DGGLRNVDCI
Download sequence
Identical sequences G1NCV5
ENSMGAP00000010619 ENSMGAP00000010619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]