SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010623 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010623
Domain Number 1 Region: 34-504
Classification Level Classification E-value
Superfamily Sema domain 4.32e-151
Family Sema domain 0.00000000371
Further Details:      
 
Domain Number 2 Region: 506-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 563-651
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000188
Family I set domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010623   Gene: ENSMGAG00000010240   Transcript: ENSMGAT00000011484
Sequence length 820
Comment pep:novel chromosome:UMD2:8:25333247:25337920:-1 gene:ENSMGAG00000010240 transcript:ENSMGAT00000011484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGDTVRLLTALLVAVAMGYPNRRSATDLDATPRMTVTFDELSGVRRFSGHSLNYTTLLL
EDERGVLYVGARGAIFAFNASNVADGSHRMIRWEASPEKQLDCLQKGRNNKTECFNHVRF
LQRLNTTHLYACGTYAFHPLCASIDADRFTLPSRFEEGKEKCPYDPSRGYTGLIVDGGLY
TATRYEFRSLPDIRRNLHQRPLKTEESPLHWLNDAEFVASMLVQESKDSLVGDDDKIYYF
FMERAGEETTSFFDKSQVARVARVARVCKSDLGGKKILQRKWTSFMKARLVCYIPYYEVL
HSVCSLDSGGWASTVFYAAFTLSAQWRTMEASAVCRYDISEVQRAFEGPYMEYQDSSRKW
SRYDGAVPEPRPGSCITDSSRRRGYNSSQDLPNSVLDFVKLHPLMFEEVQPAGGEPLLVK
RSVAYSRLAVDRVQALDGRSYDVLFMGTGDGWLHKAVVLGSSLHIIEEAQVFQDSQPIET
LVVSRRQRSLYVGAASGVLQVPLASCARYSSCYDCILARDPYCAWDGWACRDTASGDSTG
LVQDVQSGNVGCRSGSGRGKCFLPWKNRTVLCGDDVLLPCDQRSNLARAVWLLNGSEVPG
TGQEQLRVGVDGLLVTNTLPGHSGEYRCYGEERGLRTLLAAYSLTVLPQLPRATTTTTSG
PIAASQASGDTKVVYVSAIVVLVVLCAVLGTVLLYVSCLEKRRGKYVLGEPRAVSPELQT
VSASCLRKKHPQPSCPQPRSCRWLCPPPPPPPLPTELTNGVGSLPSVLRKMNGNSYMLLQ
QQDEPLSSPLYSASFTEELSKILEKRKHMQLVEKLDESSV
Download sequence
Identical sequences G1NCV8
ENSMGAP00000010623 ENSMGAP00000010623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]