SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010734 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010734
Domain Number 1 Region: 68-173
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-33
Family Second domain of FERM 0.0000837
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-22
Family First domain of FERM 0.00092
Further Details:      
 
Domain Number 3 Region: 171-228
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000553
Family Third domain of FERM 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010734   Gene: ENSMGAG00000016494   Transcript: ENSMGAT00000011597
Sequence length 229
Comment pep:novel chromosome:UMD2:12:19684367:19687958:-1 gene:ENSMGAG00000016494 transcript:ENSMGAT00000011597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQMRAQPPFTMCF
RVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGK
HPEGYSSKFQFFPKHSEKLERKIAEIHKSELSGQTPATSELNFLRKAQTLETYGVDPHPC
KDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKMKFEGKTFYLYVS
Download sequence
Identical sequences G1ND43
ENSMGAP00000010734 ENSMGAP00000010734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]