SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Meleagris gallopavo 69_2 > ENSMGAP00000010734

Domain assignment for ENSMGAP00000010734 from Meleagris gallopavo 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMGAP00000010734
Domain Number 1	Region: 68-173
Classification Level	Classification	E-value
Superfamily	Second domain of FERM	2.09e-33
Family	Second domain of FERM	0.0000837
Further Details:

Domain Number 2	Region: 2-66
Classification Level	Classification	E-value
Superfamily	Ubiquitin-like	4.34e-22
Family	First domain of FERM	0.00092
Further Details:

Domain Number 3	Region: 171-228
Classification Level	Classification	E-value
Superfamily	PH domain-like	0.0000000000000553
Family	Third domain of FERM	0.0076
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMGAP00000010734 Gene: ENSMGAG00000016494 Transcript: ENSMGAT00000011597
Sequence length	229
Comment	pep:novel chromosome:UMD2:12:19684367:19687958:-1 gene:ENSMGAG00000016494 transcript:ENSMGAT00000011597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQMRAQPPFTMCF RVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGK HPEGYSSKFQFFPKHSEKLERKIAEIHKSELSGQTPATSELNFLRKAQTLETYGVDPHPC KDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKMKFEGKTFYLYVS
Download sequence
Identical sequences	G1ND43 ENSMGAP00000010734 ENSMGAP00000010734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]