SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010812 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010812
Domain Number 1 Region: 331-462,563-816
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-100
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 470-572
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-30
Family Ras-binding domain, RBD 0.0000233
Further Details:      
 
Domain Number 3 Region: 29-148
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.69e-26
Family DEP domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010812   Gene: ENSMGAG00000010394   Transcript: ENSMGAT00000011677
Sequence length 817
Comment pep:novel chromosome:UMD2:6:31115713:31234182:-1 gene:ENSMGAG00000010394 transcript:ENSMGAT00000011677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTVLQTLSRRISNPYLETPSNKIYGESSSCAGRALRNIFTLQASDLIKDRVYLTGICRRS
CVGSELVDWLLEHCPFVKCRSTAVGVWQLLLDMGIILSVDRELYFRDTYTFYQFSADECT
YLFCEFEKEGGWKNAVKLLLQLLPLSPPRIDMCNLPDQKIEDTAETNAEILARLTSAVQR
ELAAVIALKARKSAIHQNEEHSGQEIRGLEELKSASDVQAGVLCKLQERDDIGRIELVQK
LARENCQFLQADRKQPEKTEQEDHEYTMCKFLVKKQGISLLIKKKVLSCKPCTSSRTGEN
TDEKYILESGLPQQILTKNIFLSLHVCMVKSFSAETLLDDFLLTYTVFMTTDDLCQALLS
TYCAKNHQGKEDDSDVSCRKRKVLHLVSQWTSLYKDWLHEDEHLKQFLKTIYRNVLDDVY
EYPILEKELKEFQKILGMHRRHTVDEYSPHRKNKTFFHQFSLKETWLQHRGAMNEAEEIF
CRVYITEHSYVSVKAQVTTSAQEILKIVAEKIQYPEEELALVIITFSGEKHELQPNDLAI
SKSYESSSRMFVYRRDLTDSLSPFAENEELQQRSVRILGINTWDLALELTNFDWSLFNAI
HEQELIYFTFSRQGSAENTENLSLLLQRCNEVQLWVATEILLCSQLCKRVQLVKKFIKIA
AHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFTELESLTDPSLNHKAYRD
AFKKMKSPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRSLRHCRNNQFGN
EVPSKEHHELKPYIHHLHVIDNQQALFELSHRIEPRA
Download sequence
Identical sequences G1NDA6
ENSMGAP00000010812 ENSMGAP00000010812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]