SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010862 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010862
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.48e-50
Family Prokaryotic proteases 0.000000354
Further Details:      
 
Domain Number 2 Region: 214-310
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-22
Family HtrA-like serine proteases 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010862   Gene: ENSMGAG00000010465   Transcript: ENSMGAT00000011727
Sequence length 313
Comment pep:novel chromosome:UMD2:5:59568414:59573754:1 gene:ENSMGAG00000010465 transcript:ENSMGAT00000011727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHPFSGREVPISNGSGFLVSPDGLIVTNAHVVANRRRVRVKLASGEQYDAVVQDVDQVAD
IATIKIKPKVRAVVEGLLPRLPSANPVPLFQRPLPTLPLGRSSEVRQGEFVVAMGSPFAL
QNTITSGIVSSAQRGSRELGLAASDMEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVT
SGISFAIPSDRLRKFLQKEEQRKSSWFGNAETKRRYIGVMMLTLTPSILAELKLRDPSFP
DVSYGVLIHKVIIGSPATRAGLKAGDVVLEINGQATRRAEDVYEAVRTQQSLALLVRRSY
DTLLVSVVPEVTE
Download sequence
Identical sequences G1NDE0
ENSMGAP00000010862 ENSMGAP00000010862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]